DPCstruct | MC6201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 328 |
|---|---|
| Mean domain length (aa) | 243 ± 51 aa |
| Standard deviation of domain lengths | 51.07 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.04 |
| Pfam Score | 95.09 |
| Assigned Pfam label(s) | PF14941- PF03798- CL0184- CL0123- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8XB46 | 4-200 | LMWAVITSATIWTSFYFILKQKYNLEAEWCCRFLTAIHAIIVTFLAAISSYFLGPWPMTDPGGPNTELHCIILITSLGYFIFDMIWC… |
| A0A2P6U4U3 | 282-532 | LVVEAAAVGYAVYMATLRLAQRISPMFSGYRSLPKEQQLEWDGRAPSTLHAVAITAATTWLFMVSPVFSEDHMGDVAFVLRTSPLSD… |
| A0A1X7AL13 | 94-318 | None |
| A0A7J6LNM1 | 26-266 | None |
| A0A2G2XDF2 | 36-299 | None |
| A0A2G2X880 | 37-213 | None |
| A0A5N6PCW6 | 41-258 | None |
| A0A284QNS5 | 771-1008 | None |
| G2YJQ2 | 160-409 | None |
| M1VHZ0 | 21-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.