DPCstruct | MC62007
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 124 ± 25 aa |
| Standard deviation of domain lengths | 24.75 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.70 |
| Pfam Score | 76.28 |
| Assigned Pfam label(s) | PF14275- PF19546 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A073KFK8 | 20-143 | VACSQSSSKIDKNNDVIAKGYKISNLHKFEKFALNVGNGEADKIRIVHYTDEGDPIFQTLEYDGKEVRYTSDDSHDKFAGTGKGIYS… |
| A0A2M9Q9V2 | 8-122 | YSSEEAIENGDVVNLHGEISNLNRFESFIKNVENGAKDEIRITMYTIEGDPIFYNLNYNGDKIQYTYDNSQDEYAGTGKGIASTSCS… |
| F0STT0 | 13-187 | None |
| A0A1M6YZU3 | 43-188 | None |
| A0A2N3SGF6 | 82-196 | None |
| A0A022LUL9 | 13-95 | None |
| A0A5Q2VZL1 | 190-295 | None |
| A0A1Q6K520 | 2-134 | None |
| A0A2N0F4W4 | 19-131 | None |
| A0A3A1QNK8 | 77-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.