DPCstruct | MC62004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 318 ± 41 aa |
| Standard deviation of domain lengths | 41.44 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2PSP8 | 172-462 | REYFPKKWRTAIRQRTRWVMGIALQGWERFGWSGSLGDWYWLWRDRKGLIGSPLGVIANAILLYGLATALWTRFTPLQSTLTSATLG… |
| A0A2N6BUJ2 | 2-404 | TVLTHPLHLHQTHACRPQPDETRIGEILVQENLITPLDCKQVLEIQEAEKNYSGLPFLRILTDSGRLSTKKRNRLLALPDIEKAIAD… |
| A0A661UCA4 | 38-358 | None |
| A0A348VCC7 | 274-657 | None |
| A0A847E6X7 | 3-259 | None |
| A0A7C3SUS9 | 260-557 | None |
| A0A7V2Y6P9 | 72-389 | None |
| A0A7V2Y6F5 | 39-347 | None |
| A0A7Z9LR01 | 12-310 | None |
| A0A7C1CMA9 | 590-890 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.