DPCstruct | MC62002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 461 ± 78 aa |
| Standard deviation of domain lengths | 78.05 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 13.93 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | PF13448- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6ZWK2 | 2-405 | KLAELQRDRAKLQVDHYKALLAADISELEGKQLELLGLVSGLYLTAAELAAIPNLIVGLASGSIIDFAGTVSNVAQSIGTQASITAL… |
| A0A2S9YW84 | 2-272 | AATIRLEIAERELDNHAKQVEHAQAVDAYMRTKFSNRELYDWMSSQLATLYFQTYQLAFDLAKRAERAYRHELAIDPAEPPIIEFGY… |
| A0A7R9W6W5 | 5-397 | None |
| A0A6N0Z9Y8 | 11-326 | None |
| A0A226F2A4 | 693-1148 | None |
| A0A6P8I6F6 | 6-532 | None |
| A0A3Q9D825 | 2-436 | None |
| F8CEN2 | 719-1126 | None |
| A0A835CS69 | 429-951 | None |
| A0A2P2GX15 | 248-749 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.