DPCstruct | MC62000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 917 |
|---|---|
| Mean domain length (aa) | 427 ± 109 aa |
| Standard deviation of domain lengths | 109.19 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 79.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.63 |
| Pfam Score | 62.37 |
| Assigned Pfam label(s) | PF03105- PF08352- PF16185- CL0144- CL0181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2HMW4 | 8-382 | YYLGKLLALLKPYKLYLAAILLCLIASSGIVFLQPLLISRLTDQGLLEMNLSATVKMTLLIFLLVVAGELISLLQSWMFVRIHNAFY… |
| A0A0G1H7T8 | 1-297 | MLVALYAQVYMSVLLNDWYGRYYDILQKPTEHGIAAFWNNLWEWVFIVIPYILVATGVSYFTRLYTLQWREAITFNYIPRWRNVHEE… |
| A0A239QSG7 | 2-431 | None |
| A0A0F9U210 | 305-903 | None |
| A0A1I8IBX7 | 459-942 | None |
| A0A1I8IA62 | 735-1238 | None |
| A0A0K0E7L9 | 141-681 | None |
| A0A6G6X543 | 2-261 | None |
| A0A101MLW3 | 610-967 | None |
| A0A834S1Y9 | 50-531 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.