DPCstruct | MC6200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 209 ± 33 aa |
| Standard deviation of domain lengths | 33.04 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 24.27 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF17184- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6U2E0 | 15-197 | CHHYINLTNGIEAVPSLQLLGLPYSFLRLPSTRCEQQQFEELMHDLDADLLMRLALGQTCLVYDLGSRNKKRGAPRAVWYGLEFIRF… |
| A0A6H1Z9D1 | 3-156 | VVYYINLTNGIEAILTLNDYRFVRIQSTACEQKRWNFILQDLDTDLLMNLAIGNTCIVYDFGHSGMPRALWQGVPFIKFTLCKLWLG… |
| A0A0G4KDG1 | 24-272 | None |
| A4S4R3 | 24-216 | None |
| A0A2V0PI25 | 149-324 | None |
| A0A287X8D7 | 2-202 | None |
| A0A5N6PLM0 | 1-254 | None |
| R1C8G7 | 31-228 | None |
| A0A5J4YM99 | 99-308 | None |
| C1MZZ2 | 48-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.