DPCstruct | MC62
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 55 ± 4 aa |
| Standard deviation of domain lengths | 4.38 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 50.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B9H916 | 29-79 | YQAIALHMSHPRDDSYTPSKISIRAGTGVHDLQEVRFIEFNKPDGWIPIVL |
| A0A164UH19 | 39-94 | SSFVLYVDYKLDESYTPSKIAIRAGDGFHNLKEIKSVELVKPTGWVYISLSGNDPR |
| A0A7R8H9R9 | 103-153 | None |
| A0A7J0E1U7 | 205-260 | None |
| A0A368FDD5 | 87-142 | None |
| A0A4Y7N3C2 | 78-126 | None |
| A0A5D3D589 | 153-208 | None |
| A0A0B2PB85 | 1-57 | None |
| A0A1D6FJG7 | 86-148 | None |
| A0A6F9CB72 | 359-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.