DPCstruct | MC61998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 332 ± 27 aa |
| Standard deviation of domain lengths | 27.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2H631 | 5-287 | GEVKQFVRGGRGITLAGGGRSISESTLQMLDSEAFCQITDTLGYEETAIFSPDERYAICMSPRFSPETDCGVLGVVPLYNDIATRGR… |
| A0A4Q4SWD5 | 2-337 | LQPIITSGTNLYINPSAISVGELRGFTGRGLEVTYVGYPAESSNIDVFAVGLLDGKVRRLTTHPEYADPIDFSPDDKWFAVMDTRGS… |
| A0A366PVC2 | 638-1004 | None |
| A0A0U4Z377 | 759-1124 | None |
| A0A1U8QWQ5 | 54-393 | None |
| A0A1B8E937 | 281-600 | None |
| A0A428NJ82 | 279-623 | None |
| A0A7W9NJZ2 | 225-554 | None |
| A0A0B7KSI8 | 188-526 | None |
| H0E1D1 | 209-556 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.