DPCstruct | MC6199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 205 ± 36 aa |
| Standard deviation of domain lengths | 36.07 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L7E1R4 | 17-199 | SLWNSKKIIIQSFLKEFDLENPMILNHMENLGEYIELESQLVASEKITLEDVIRASELRSSDLRIIHTILVQMSGKSYRAEIFEILS… |
| A0A7J7Q3T0 | 28-237 | AGCDQQQQEQQHTFQGQEVLVQVLEQQQLLSERVKEELTMGQLYWQQERHICSQLASTQPGREAMLTLAEIVAAHESKSFDYRVLHL… |
| A0A2K3P3T3 | 24-223 | None |
| A0A7W7FSY3 | 51-281 | None |
| A0A388L7R2 | 252-461 | None |
| A8JIJ3 | 4-154 | None |
| A0A803KXQ9 | 57-283 | None |
| A0A840Q571 | 42-254 | None |
| A0A5N5FGE3 | 286-524 | None |
| A0A1D6E9F6 | 10-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.