DPCstruct | MC61986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 139 ± 25 aa |
| Standard deviation of domain lengths | 24.82 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.84 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 50.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06424 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178URT2 | 1-129 | MPPSNYIAGLGRGAAGFTTRSDIGPARANGDGDADVNHKFDDFEGHDAGLFANAESDDQDKEADAIWDAIDRRMDSRRKDRREAKLK… |
| A0A024V4M7 | 36-164 | KPPPGYIPGKGRGVTGFSGGVSRDDTTDDKDKNDYSDFNYDEFHGYSESLFKDTEYDEEDKEADEIYDKIDSLMDIRRKSRRENKLK… |
| A0A4Y7NMI9 | 247-427 | None |
| A0A443PTW1 | 2-133 | None |
| A0A811LKW8 | 18-183 | None |
| A0A2H2IIG1 | 20-179 | None |
| A0A821PSW7 | 12-160 | None |
| A0A7J7JYY1 | 18-166 | None |
| A0A1S3D9F5 | 1-152 | None |
| A0A2G9UJ37 | 18-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.