DPCstruct | MC61981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 167 |
|---|---|
| Mean domain length (aa) | 109 ± 25 aa |
| Standard deviation of domain lengths | 24.50 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 26.04 |
| Pfam Score | 85.70 |
| Assigned Pfam label(s) | CL0023- CL0167- PF13368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9JZE5 | 15-103 | DVCEKCESPMVIKTGRFGPFLGCSNYPKCKNIKNLNVSEGPTIKCPKCKEGNIVQKRSRRGIFYACDRYPDCKTAFNSKPTGDMCPD… |
| A0A7X9EB97 | 4-83 | PKCPFCLTGHLVIREKDTGTNFLGCSNFPLCEKTFNEIEILNNRIICNLCGGYMVKRKGRYGEFYGCSNYYYCKNTLQID |
| A0A7K4HIK8 | 148-233 | None |
| A0A1F8F9H5 | 1-83 | None |
| A0A1V6HZM7 | 27-122 | None |
| A0A3N5PHD8 | 24-147 | None |
| A0A7V2NQL1 | 3-92 | None |
| A0A1V1P5L5 | 450-529 | None |
| A0A7V4PCN2 | 262-426 | None |
| A0A3A0CQV5 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.