DPCstruct | MC6198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 138 ± 19 aa |
| Standard deviation of domain lengths | 19.38 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.41 |
| Pfam Score | 99.17 |
| Assigned Pfam label(s) | PF08510- PF10241 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B8MXN0 | 36-152 | VGEIYGFVGAMTTTVFTVVYFAWAYTPEKVLHAVGIYYYPSKYWALALPVWLSVLAVVMFWLYEFYNLACTPPLHSLDNVRDEHCRW… |
| A0A2P6U0J6 | 13-151 | GEGVSSVEVFGFVGWITSSVAYVLYMLWSYVPNSVLEAYGIHYYPSKYWAVALPTWVCVTVVAVYWAYEGLCMMSALPPGDPSNLRD… |
| A0A1Y2HY72 | 34-168 | None |
| A0A388KRW5 | 234-374 | None |
| A0A0S4JL03 | 15-137 | None |
| A0A0D2HPD5 | 282-437 | None |
| A0A4S2N750 | 72-245 | None |
| A0A066WGU2 | 256-389 | None |
| A0A0G4MU01 | 90-247 | None |
| A0A6P8RKF5 | 10-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.