DPCstruct | MC61975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2319 |
|---|---|
| Mean domain length (aa) | 188 ± 32 aa |
| Standard deviation of domain lengths | 31.96 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 15.60 |
| Pfam Score | 94.97 |
| Assigned Pfam label(s) | CL0213- CL0020- PF00045- PF11901- CL0592 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5XMB8 | 7-178 | ECPRWSPGSVIRWSAWRQGFKTDEDAAFAADHLNMAAEKWNSLNIGVTFEWVPLAKDATFVLCHGGSHGGALAQAFFPNANDLNYLL… |
| Q8ZW37 | 2-154 | RPRITVVAPSRIKPLEIPEFTTIWQFKDIDISHFLDLARGQCRADKVVEALSNGVKSPTVYVLDCDGYYPGLNFVFGLAVPVLKTAV… |
| A0A0S6W4H7 | 143-345 | None |
| A0A0K0E6A2 | 7-163 | None |
| A0A1H6CJA4 | 55-220 | None |
| A0A0U3B8M8 | 14-182 | None |
| A0A7Y1ZXS0 | 47-249 | None |
| E7FAQ0 | 15-214 | None |
| A0A1V6S3X7 | 3-178 | None |
| A0A3N5G770 | 2-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.