DPCstruct | MC61972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 272 ± 39 aa |
| Standard deviation of domain lengths | 38.58 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5XC37 | 2-285 | PPDVSALPPELWIRILSHHPDPVHLWSTCRILSRTWQSYVETVVSTVYLRYFASICFSLEKYNLGGKTARPEISCTFDRFEDESADK… |
| A0A6G1K826 | 7-315 | PNVAHAPLCPSLPPEIWIRILSYHDDLTHLWSICRAVSPTFLAYSEQVFAEYILRDTYIDWALEKYNLGGKSRRPEMNVTFARFSSD… |
| K2S8S8 | 76-377 | None |
| A0A4U0XIC6 | 2-238 | None |
| A0A3N2PU97 | 36-346 | None |
| V2WTQ4 | 1-236 | None |
| A0A0S7DMM1 | 430-691 | None |
| A0A6A5YVT6 | 29-281 | None |
| A0A6A5X1P0 | 50-344 | None |
| A0A7C8M718 | 312-600 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.