DPCstruct | MC6197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 576 ± 62 aa |
| Standard deviation of domain lengths | 61.72 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.92 |
| Pfam Score | 91.11 |
| Assigned Pfam label(s) | CL0023- CL0029- CL0110- CL0723- CL0197 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6TZZ8 | 8-535 | VFRAGLLSTGEELKARYDASKPYPHCVIREFCNPDLLRKVRDEIIENVEATYKETDLFKMLQTGDLANMDALPAEQAAKLPTVRKLR… |
| A0A674F1Q1 | 2-464 | RTAGFLDCQPFPHCIIRNFIQSDSFTENLQRELLDLNFHEKSNDLYKFNQSDDLKKRKEPHITGLRAALFGLFRSWLGEVLGVELEP… |
| K0THN4 | 44-639 | None |
| A0A178F0X1 | 574-1241 | None |
| A0A225AUP8 | 359-1008 | None |
| A0A1S3J992 | 237-754 | None |
| A0A5C6NN66 | 13-559 | None |
| F1KZR8 | 19-539 | None |
| A0A6A6P813 | 2-538 | None |
| Q01F03 | 6-513 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.