DPCstruct | MC61969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 164 ± 32 aa |
| Standard deviation of domain lengths | 32.38 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21527 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848EFB3 | 29-196 | SSPVTTLTNYYLIGNTTGKDSCYIISHGGQHRKDYWLDNMSFKVPAGVTVSFFHDHGDIFSYSYNRFASGDASDLPVVKASDGKKVY… |
| A0A841G5E9 | 34-139 | GQTVFAGHGVYRGDGYFTVPQGTTIKFYGPHGKGLSQSKGLKVERGSWRSPIEVYGPGDRIPDYVLKTPDRLKIMSGSQTVSDSTRL… |
| A0A0P9ZL92 | 379-573 | None |
| A0A5U9SSI7 | 36-205 | None |
| A0A7X8SKW3 | 24-159 | None |
| A0A856BKP5 | 656-779 | None |
| A0A2S9YBY5 | 714-848 | None |
| A0A4Y9SYZ2 | 8-140 | None |
| A0A3M6FKF0 | 282-483 | None |
| A0A486XKZ6 | 964-1214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.