DPCstruct | MC61963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 96 ± 12 aa |
| Standard deviation of domain lengths | 12.45 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08463 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7IWB5 | 16-114 | QDYELEYGTKPLGEFVREIVGLDMNAAKEAFSEYLTGTNLDSRQIYFVNQIIEYIVHNGVLKDFSVLQESPFTDQGSVVEIFTDMTV… |
| A0A0F9QHX7 | 15-115 | SGLLERSGAPSLPYFVRSLVGMDEATAKQAFSDFLTDTSLTAAQIRFVETVIEQLASRGVIEPSALYEPPFTAFHAGGPEALFAGKD… |
| A0A385YZL5 | 77-148 | None |
| A0A4M9XE73 | 3-88 | None |
| A0A087CTX1 | 1110-1206 | None |
| A0A844FJ68 | 30-127 | None |
| A0A498QAX8 | 136-216 | None |
| W0DMX5 | 75-170 | None |
| A0A4R8UBW3 | 316-412 | None |
| A0A0C6FDR9 | 8-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.