DPCstruct | MC6196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 161 |
|---|---|
| Mean domain length (aa) | 80 ± 16 aa |
| Standard deviation of domain lengths | 15.87 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 36.06 |
| Pfam Score | 98.96 |
| Assigned Pfam label(s) | PF01809- CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6TSP2 | 118-191 | SIGVRAALAALKFYKGAISPLLPPACRFLPTCSVYSMDAFQRYGVGKGFVLTAWRLLRCQPFSRSKGYDPVRWP |
| A0A847F4R4 | 2-84 | SPLARILLWLITFYQRRGGGERFLVSCNFEPSCSRYTHEAIARFGAIDGMRLGHARIHRCNRPDLLDPIGDPVPSSEEYLEEV |
| A0A3C1WK66 | 2-96 | None |
| A0A0N1EKI1 | 1-50 | None |
| A0A286RHV5 | 244-312 | None |
| A0A7C3QT17 | 48-131 | None |
| A0A7V3F4S0 | 2-87 | None |
| A0A1W9QY80 | 4-87 | None |
| A0A7V2AIN1 | 9-81 | None |
| A0A0D9XVR7 | 21-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.