DPCstruct | MC61956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 103 ± 13 aa |
| Standard deviation of domain lengths | 12.68 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844RUK7 | 3-106 | EDYLGTSESSFAWNEFEKQSLEAALDQEDEERVKEFWGKHLPIFISVKDGYSFIALSLLEGQAGAVVVGREPEYEETSVICDDLEGF… |
| A0A1Y0ELI2 | 23-125 | VWFYGLADHAGQSDAAFSWDFAQRLSLDAAVSEADTWAVRTFWQAHTPFAASVAGDYAYLALRHDGAVVVGQGPEFEESAEWLADSL… |
| D4XIZ0 | 124-220 | None |
| A0A3A8ZG31 | 114-210 | None |
| A0A401N1E2 | 2-118 | None |
| A0A3G2GJZ8 | 35-146 | None |
| A0A0C5XH93 | 10-118 | None |
| A0A7W9W9C9 | 180-276 | None |
| A0A845R9U5 | 158-261 | None |
| A0A839F432 | 58-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.