DPCstruct | MC6195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 78 ± 17 aa |
| Standard deviation of domain lengths | 16.55 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 54.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A059AG00 | 21-98 | YKVIEITPPPRSLGVRCFPSNLQCGESVTIEGQAYTISAVTHRYQLRKGKYEPSEKRLDVLSTGRYILNLYLDNLYEQ |
| A0A2P6TPE4 | 18-79 | ALPPSTHNGDLIEVEGSAYVVQSVVMQYKLVRGRYKRDHARLEVQGTGRMLANLFLEELYQK |
| A0A0G4HAG7 | 155-239 | None |
| A0A4D9BVX6 | 13-70 | None |
| A0A7S1DEN9 | 241-318 | None |
| A0A7S0C8L8 | 48-156 | None |
| A0A834Z3G2 | 66-142 | None |
| A0A7J6FK61 | 5-69 | None |
| A0A565C727 | 14-103 | None |
| A0A2V0PIP7 | 84-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.