DPCstruct | MC61949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 298 ± 45 aa |
| Standard deviation of domain lengths | 45.23 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 68.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 35.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835NRZ6 | 12-326 | QVIMIILLLFWLVQWIHHYINVYPDQDLHQQRTQMLQELVHRTVEPSVGSWGAVLSTALQQWLFWAIAGALVLLLALCWWLKKRICE… |
| A0A2I0UBC3 | 6-293 | VLVLLLLSTMRLLPMVGNELDEATRVRVQQRAALPNMEMTGLLQDVEERNLEETKAILEESDFSWGALLFAAPLKQWQFWVLAGELV… |
| A0A2I0UG72 | 1-338 | None |
| R0LF21 | 142-396 | None |
| A0A6I9Z9X4 | 6-276 | None |
| A0A226M6F5 | 7-232 | None |
| A0A669R2W8 | 4-375 | None |
| A0A493T0Q1 | 4-350 | None |
| A0A226MUW9 | 28-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.