DPCstruct | MC61941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 168 ± 36 aa |
| Standard deviation of domain lengths | 36.35 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 75.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G7EFG5 | 301-429 | GNDSLLVAQRIDAWASCWCIRQFQQIGGASVSVWRELRRLSSIFNDKKDSLLEQARFAADNSDWKGYILAMGGLHTKQKDRPIKLHY… |
| D4B829 | 32-202 | AAVTAWASTWRIPQFKSIGLPTMGAYRELRKLPRGVSIADEFDERVEATRAAADEGEFDLYIAAQGGANVPRDSQTVRVARNVTDEV… |
| A0A2X3F9H1 | 6-140 | None |
| A0A7S7WIN1 | 111-285 | None |
| A0A3G9GD73 | 377-564 | None |
| K6YMQ6 | 15-149 | None |
| A0A238TAY0 | 329-514 | None |
| A0A7H4P5P2 | 174-364 | None |
| A0A077QHV8 | 2-183 | None |
| A0A1T4UFK5 | 688-806 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.