DPCstruct | MC6194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 303 ± 31 aa |
| Standard deviation of domain lengths | 31.25 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6TP48 | 188-516 | RAAAAAGGSAPLGECDGEASPRRSMYKRAAQAWEQTNQALAEDWHYNLEFDRFFWGLTLCIYTVFTAKMVPQLSVQENIENLGIYLG… |
| A0A2P6VSK9 | 204-552 | LSQQQYVERRQARQSEQQEEMELQHAELRPEGGAVQGAVFLPGSCERPFFVRLNRLRASQACDRVAYPLVMILALMTAARSWGRSVP… |
| A0A2P6TQ17 | 2-264 | None |
| A0A2V0PIB4 | 1-339 | None |
| A0A2P6TYP7 | 265-550 | None |
| A0A2P6TXM2 | 1-252 | None |
| A0A2P6TRI1 | 2-308 | None |
| A0A2P6TG59 | 1-328 | None |
| A0A2P6TL87 | 4-296 | None |
| A0A2P6VCY6 | 2-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.