DPCstruct | MC61939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 284 ± 45 aa |
| Standard deviation of domain lengths | 44.51 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W4HPL8 | 34-350 | TYSKEDMEAVIPVAEKIILSQGYIPPSNKAFSEKVQMIFKRKIDFNLSSKYLYLNFNEKCDKEVKYYRNDKSVDVTPYSYYIIKNSN… |
| A0A327VQE8 | 11-272 | QYIKESELRKMLQGMQQRGYRFPDKSAFRNKVLAMTGIDLDTSAFNDVRLAVTKDDGPTLWAIRHVGLLIPAEELDYIALSYDQHGQ… |
| A0A2M9BX34 | 2-262 | None |
| D1QV48 | 10-288 | None |
| A0A2H1XZ16 | 54-312 | None |
| A0A1H8D3W5 | 70-466 | None |
| U2C7J2 | 27-234 | None |
| A0A2V2ZMX9 | 64-393 | None |
| G1VIT4 | 19-301 | None |
| A0A250FNT9 | 17-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.