DPCstruct | MC61936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 124 ± 14 aa |
| Standard deviation of domain lengths | 13.96 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 29.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A427KE77 | 5-128 | LQRVKELHALYDKSNKINHLTIDGNRIDLGTEGRRYGTAKVFNSQKLTDKQIHNYAQELAGNKKLEPVGPGVFNAKLGDGSSITLRS… |
| A0A7X3L279 | 34-165 | SGTILQLQSQRKIDELAAQFNNPAVQPKDFQISLDGKVLKADPEVSLGAPVYAGATTADVMSYFRKLAGVDEIPTVRTVAGKGDVFS… |
| Q9P9U8 | 116-252 | None |
| A0A837PZ43 | 53-189 | None |
| A0A096AWE1 | 160-295 | None |
| F2LES3 | 207-323 | None |
| A0A5C0AB47 | 632-744 | None |
| A0A0S4VT49 | 65-201 | None |
| A0A483ALE2 | 4-102 | None |
| A0A381DI47 | 807-936 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.