DPCstruct | MC61933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 149 ± 17 aa |
| Standard deviation of domain lengths | 17.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U6VIU5 | 2-176 | LTRGLGMGLEIPLTLADVDAILRLRDMELKSMASGSKAFMACVAEGLGSSLDWDQAMVYQRKNGSFFNSPATTAAVAIHNHNGRALD… |
| A0A7J6VP38 | 3-141 | LLHSLEGIPDLDWEKLLKMQHPNGSFLCSPSSTAYALMQTKDENCFRYLAGIVQKFNGGVPHSYPMDLFEQLWVVDRLERLGFSRFF… |
| A0A7J6EZG1 | 175-342 | None |
| A0A199VT57 | 223-360 | None |
| A0A5N6PT62 | 428-572 | None |
| A0A0E0QPM8 | 193-373 | None |
| A0A2G5D4P9 | 196-335 | None |
| A0A484M8D2 | 179-326 | None |
| A0A6J5X8D8 | 16-152 | None |
| A0A7J7GUV3 | 67-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.