DPCstruct | MC6193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 159 ± 26 aa |
| Standard deviation of domain lengths | 25.86 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02341 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830HVX1 | 1-131 | MHIPSDGFGGVSPERKAAQALTSLVTFAAAKAVLAQMSGSGRGALGAYNAEGYRALEYALENESLRDADAWLLKLTKANNLVGVRIA… |
| A0A2P6TFZ0 | 427-576 | RAAQRPAAKMAVPHDTFGGSSPEQRAAASLTTMFTFVALRVVLSQLGPGGEGGDLPPTPDYMWLRHFLEENPLRNGNEWLAEMMAQD… |
| M8ARY6 | 1-220 | None |
| B9RID3 | 19-160 | None |
| A0A5A7RBE0 | 153-305 | None |
| A0A067GI59 | 1-136 | None |
| A0A540MIX4 | 85-203 | None |
| A0A5N6QAV5 | 65-214 | None |
| A0A830HMN4 | 7-180 | None |
| A0A2U1M6N6 | 30-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.