DPCstruct | MC61924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 4.51 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 45.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7QAW8 | 358-418 | ELAALEERHRQEISDTKKKQWCYNCEAEAIYHCCWNTLYCSVECQQVHWHKEHKRSCRRKQ |
| A0A564Z5F8 | 131-189 | QIHEMGERHARELEEAKKHEWCRRCLKKSIYYCCPGASYCSTDCQKADWTAGHSTFCRR |
| A0A0K0E905 | 106-169 | None |
| A0A7R9LWL5 | 43-104 | None |
| A0A1I8F8N2 | 119-196 | None |
| A0A485NU91 | 385-445 | None |
| A0A3P7RLB6 | 74-135 | None |
| E4XX08 | 102-165 | None |
| A0A5K3F5U2 | 554-619 | None |
| A0A5K4F238 | 1155-1216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.