DPCstruct | MC61922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 672 |
|---|---|
| Mean domain length (aa) | 134 ± 20 aa |
| Standard deviation of domain lengths | 20.38 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 14.88 |
| Pfam Score | 77.90 |
| Assigned Pfam label(s) | CL0023- PF00305- CL0321- CL0168- CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E4YPC6 | 4-124 | ERETIKIQVIVRTKDTDCAGTDANVFVTLIGEEGETGKMELKTSENHLNKFERGKIDIFHFEIENIGTVTDMIIEHDNKGLGSSWCV… |
| A0A5K6V511 | 124-244 | DPSVGKNVKELVAYISTSGEKDAGTDDYMYFGIKTKDGKTQEWEMDNPGNDFMTGSKDTYTFKLKDENLKIDDIQNMWIRKRKYTAI… |
| A0A7R9KKQ3 | 98-229 | None |
| A0A7R9KQ65 | 190-321 | None |
| A0A7J0FWK6 | 12-179 | None |
| A0A6S7G6I6 | 5-128 | None |
| C3ZMK7 | 4-126 | None |
| A0A5N5TK77 | 469-588 | None |
| A0A538Q263 | 262-374 | None |
| K8ENU9 | 136-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.