DPCstruct | MC6192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 186 ± 26 aa |
| Standard deviation of domain lengths | 26.14 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 32.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6U1R3 | 204-413 | LGVMLQVARQLAGTADRCTQEWASKLLANWHGLVQALPPSVPAADQSAATLDVSEEMVAELQTAASALSEQRRQLLRRLQFNTDLAD… |
| A0A2P6TE36 | 3-211 | RSGTLQSLLQDARRLQDGNDACGAAVLVVIAIKALQSLDRGASEAASTWATATPQQLPLLQKLQLAQGVSAGLADSSEAGGFPVLLA… |
| E1Z3I9 | 295-483 | None |
| E1Z3B1 | 497-701 | None |
| E1Z219 | 784-979 | None |
| A0A2P6U2V2 | 342-540 | None |
| A0A2P6U2B9 | 688-914 | None |
| A0A2P6TZK4 | 22-229 | None |
| A0A2P6TGH3 | 595-782 | None |
| A0A2P6TRH7 | 71-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.