DPCstruct | MC61919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 151 ± 31 aa |
| Standard deviation of domain lengths | 31.03 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 48.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F1A0P8 | 4-146 | EEVTTLLNVVETTFAALAAENAWLNKFIVQSCYVFDGEQGELSDAYICAIDGRMPQTQVTDAFLDEVKTEARKEGAYFVANRMLAAW… |
| A0A0H3PVQ8 | 2-109 | EGFLRGKCVPRDLKVNETNAEYLVRKFDEVRAEARNEGINYTASRLAAAFNHGFINKPLAEVFDVTRMILSAKEELANESHPIDGLS… |
| A0A600Y6I8 | 29-179 | None |
| A0A3L1GKY9 | 38-209 | None |
| A0A827JJ94 | 23-215 | None |
| A0A3G2C8S4 | 29-181 | None |
| A0A5U3G383 | 4-168 | None |
| A4WC61 | 6-184 | None |
| A0A6M8UMC4 | 44-221 | None |
| A0A6S5JTV1 | 17-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.