DPCstruct | MC61911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 5.77 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 33.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151ENI0 | 11-88 | KKTSPILRREILRAVENQIRDENPLITKKTLERLMKKGYSREDAVVLIGSALLTEIYWILKNEEPFNEERYTKELNAL |
| A0A658G9G2 | 14-88 | EETLIQAIENQLEAGEPAATQATLNKLTLVGYERDEILKMMALVLAHEIRQMLEQDRPFDTEGYETQLRNLPDLP |
| A0A7C6XK50 | 66-149 | None |
| A0A3A9FBV6 | 7-99 | None |
| X0NYI2 | 3-77 | None |
| A0A368Y4G6 | 2-78 | None |
| A0A3D5DW29 | 140-219 | None |
| A0A1D8GLM1 | 1-83 | None |
| A0A7V7K1E2 | 7-85 | None |
| A0A1F4F5T7 | 2-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.