DPCstruct | MC6191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 171 |
|---|---|
| Mean domain length (aa) | 235 ± 56 aa |
| Standard deviation of domain lengths | 56.21 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 83.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.58 |
| Pfam Score | 84.57 |
| Assigned Pfam label(s) | PF00410- CL0267- PF01000- CL0266- CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I8TRZ7 | 1-287 | MAEVPSVAIEFVFVHNNTSVIQDEVLAQRLGLIPLKGSVDGINWMRWFKKATEDDPEGSDPSDYNTIVLRLDIECTKNPNADATEND… |
| C4V9J5 | 2-224 | KILIEESTDNIIKFTLRDTYVSYANALRRILISEVPTVTIDLVEIEINNTSLPDEMISHRLGLVPLYTKKDLVFRDDCACDDICDKC… |
| A0A5D2VIZ3 | 73-187 | None |
| A0A6A5DR29 | 155-418 | None |
| A0A3P8MUL4 | 8-312 | None |
| A0A4Y1QC96 | 1-346 | None |
| A0A446JIG1 | 117-242 | None |
| A0A1B0C7F8 | 193-432 | None |
| A0A2G8LDL2 | 51-251 | None |
| A0A388NNQ7 | 6-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.