DPCstruct | MC619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 60 ± 7 aa |
| Standard deviation of domain lengths | 7.45 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4Q4X9 | 189-247 | KKFLRFRPDFQCGSRVPLLPDEEPVECNPDSDTPCCSALGWCGKTKLHCKCPTCIDYRQ |
| A0A0N4X721 | 81-149 | FKYKPVEWWTYAEKPANVGRCGPDTERLPSGKIAKCDPDGEAYCCSRSGYCGRGSDYCECLGCVDFKKH |
| C3ZNG1 | 292-344 | None |
| A0A0R4I979 | 3-56 | None |
| A0A2G8LBS6 | 230-286 | None |
| A0A7J6QEL5 | 450-504 | None |
| A0A6P4XJH4 | 20-93 | None |
| A0A6P4Y5A3 | 1-47 | None |
| A0A6P4Y7E4 | 303-362 | None |
| A0A6P4YP45 | 141-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.