DPCstruct | MC61898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 274 |
|---|---|
| Mean domain length (aa) | 148 ± 22 aa |
| Standard deviation of domain lengths | 22.49 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10646 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9DIG4 | 26-187 | CGGAETTADAEERAGAVALVAPHSKAPTRTTVYFLADNGTVPLGVRRDLMRRPNVPTVRLALEELLAGPTAAERGNGLDTAIPAETK… |
| A0A3N2CWM5 | 157-282 | FPTVQRKVYFLDRDNYAEGRRPYFSARLRPVPVRTPAVGVMDRLFAGPLPGEKADGLELLRSGATSFRDLRIADQVARVRLTGGCSS… |
| A0A7K3GDJ1 | 481-628 | None |
| A0A7L5AP23 | 329-453 | None |
| A0A1G9XCR3 | 211-323 | None |
| A0A7V8Z2Y7 | 57-229 | None |
| A0A7V6H3V6 | 1-186 | None |
| A0A4R2JL42 | 18-148 | None |
| A0A1E7KCC2 | 2-196 | None |
| A0A845WDS3 | 23-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.