DPCstruct | MC61892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 160 ± 39 aa |
| Standard deviation of domain lengths | 39.48 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 92.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 38.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534CEX8 | 530-707 | MAYDPKLDLLYVGVGNGSPWNQAYRSPGGGDNLYIDSIIALKPRTGEYVWHYQTTPGDTWDFDATQHLILADLEIDGRPRAVVMQAS… |
| A0A2V9C7T8 | 64-181 | RWYFQLTHHDVWDYDAEAAPSLMDVVHDGKKIPVVVAISKPGLMFFLDRDTGKSVYPVEERPVPQSDVPGEETWPTQPFPVKPAPVA… |
| A0A855HMZ4 | 26-128 | None |
| A0A1G3XQM9 | 133-322 | None |
| A0A2D6PUC5 | 269-474 | None |
| A0A2V7Y9V5 | 274-418 | None |
| A0A7G8BFS9 | 233-446 | None |
| A0A843T2Z6 | 244-458 | None |
| A0A7H4PA28 | 408-598 | None |
| A0A484XTU4 | 77-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.