DPCstruct | MC6189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 121 ± 9 aa |
| Standard deviation of domain lengths | 9.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H1ZD22 | 4-130 | TEKCQHCGHEIRAYIHKLNQPLVSALRQLVDRHEELRRSINLQKDLTLTKNQYNNFQKLTYFGLIGHTTNGWYPTQHGIDFVYGRQS… |
| A0A2E6HFZ9 | 3-118 | EYKHGLSKGLCRSLAKVVTKFGERAMFGQDIAQMGLKSSEYCNFQKLRYWGLVVKVGDDGGKGGKWRVTRKGMDFVSGNLTVPRFVW… |
| A0A7C7C9Z6 | 109-240 | None |
| A0A521S9Y3 | 13-138 | None |
| A0A497RPI9 | 19-144 | None |
| A0A2G7CV19 | 1-105 | None |
| A0A497BHQ6 | 52-176 | None |
| A0A660MA03 | 21-153 | None |
| A0A660WFC9 | 31-156 | None |
| A0A0B5FJD7 | 74-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.