DPCstruct | MC61888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 120 ± 12 aa |
| Standard deviation of domain lengths | 12.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.23 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | PF14219- PF14018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U1HIW8 | 11-127 | GGPPMEERSPVTLLALGFITCGIYYLIWKYQTTEELQRVSGDMTIKPGLDLLLTFVTCGVWAIYTDYRNAKKAHELFLSYGVNRPDR… |
| A0A355E515 | 9-120 | AEYRHDIALGIILSIFTCGLYNIYWNYREFLAMNQLLGREEYRFWYWLGLTIITCGIFHIYYEYKMGSDLHDIIKGRGLEVNPNLAT… |
| A0A1V4WN23 | 74-190 | None |
| D3Q459 | 40-157 | None |
| A0A3A8V4I7 | 231-347 | None |
| A0A497I5X0 | 26-129 | None |
| A0A5R8QHY5 | 6-122 | None |
| A0A4Q6F6G6 | 14-122 | None |
| A0A1U7NQS0 | 4-116 | None |
| A0A1Y4F5K7 | 40-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.