DPCstruct | MC61878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 108 ± 18 aa |
| Standard deviation of domain lengths | 18.18 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 52.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8QIS1 | 5-107 | RGLNVSLSTDDPLQIHLTKEPLVEEYSIAASVWKLSACDLCEIARNSVYQSGFSHALKSHWIGKEYYKRGPNGNEIQRTNVPHIRLE… |
| A0A814IS41 | 252-355 | FQRGLCVSLSTDDPLQFHFTQEPLMEEYSIAAQIWKLSSIDMCEIARNSVLMSGYSDEVKKAWLGLHYKESGVADNDIRRSNVPNLR… |
| A0A7G2CJX6 | 301-410 | None |
| A4HVM6 | 1476-1646 | None |
| A4HS23 | 1475-1540 | None |
| K1PVW9 | 74-198 | None |
| A0A086JZI8 | 453-545 | None |
| A0A395J2Q2 | 9-96 | None |
| A0A1I8FIS9 | 305-419 | None |
| A0A7S1MNL8 | 107-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.