DPCstruct | MC6187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 312 ± 40 aa |
| Standard deviation of domain lengths | 40.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C5ZVH6 | 194-483 | APTPLPEPPPAATYVPFKSGMSVIDQLEWSKQQQQAGHIIAAFDALPPKYQADIEQLAKTAAAKIDAATLQSIISSIHQIGDVIVTK… |
| A0A2E5EIY2 | 103-423 | ANDPGADPAGMGNPGGNPLEDGSMNPLASMAAGSTPIEIPDTPDGTVNTVIGALANGNPRGFWDALPPSYQADITKRISEQFAAEDP… |
| A0A2G6JJA4 | 3-298 | None |
| A0A358KHP2 | 27-328 | None |
| A0A521K8Y1 | 11-304 | None |
| A0A518JVD4 | 72-385 | None |
| D5SZ27 | 66-408 | None |
| A0A7Z1QY71 | 1-233 | None |
| A0A7C3KT05 | 20-265 | None |
| Q8P3E2 | 178-534 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.