DPCstruct | MC61861
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 199 ± 12 aa |
| Standard deviation of domain lengths | 11.60 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R9E3M3 | 1-188 | MRRRRPVRARTTLRAERLPGPGALYRLRVRTENTCVGVPAESGRDEALAHALIATHTFIGGEQVAFFSSIDPPEEVAEHTRDCANLH… |
| A0A7W1LB91 | 95-299 | RGLEPLRDENEQIVGVIIRTQQEIFGVIELQVEEVSSQQLAISSQKLFKLTVRVKNLTALENAKEQSRDDALLHSLVSTHTILSATD… |
| A0A4Y8LVU0 | 27-226 | None |
| A0A7V9PTH9 | 2-186 | None |
| A0A1I2FFS0 | 77-251 | None |
| A0A3N4STQ6 | 168-373 | None |
| E3J6G0 | 211-405 | None |
| A0A368VVG7 | 387-595 | None |
| D6TEX2 | 127-329 | None |
| A0A1M6PZT4 | 113-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.