DPCstruct | MC61860
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 64 ± 9 aa |
| Standard deviation of domain lengths | 9.47 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A385DBG8 | 67-129 | DVDRRDLRPATPGELSGTGHWMYETAVRDSQGALADGITYLFGKAECPSCASVFSIADEYGSA |
| A0A1H1Y0U2 | 153-215 | TKTVVEQTPLLPASPADLDGAGQRLYQASVQHGQTAIATALTYLFGHAICTQCSTEFRVSDQV |
| A0A1A9DH71 | 90-177 | None |
| A0A0F0HDT0 | 79-137 | None |
| A0A4Y3RWN4 | 21-83 | None |
| A0A428YD49 | 108-172 | None |
| A0A233S258 | 41-97 | None |
| A0A1H9BCP8 | 574-629 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.