DPCstruct | MC6186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 288 ± 53 aa |
| Standard deviation of domain lengths | 53.26 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0312 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T0A635 | 29-369 | LWQTYQAKKADTPMLFPTEGAKLLGVSEFELLLSSPNSVYLGSDCRPMLLRLHELGQVENIVRNEFAVHEKTGQFLGLELGQTMGMA… |
| A0A2E5EIW9 | 37-311 | HVSLSVPRDVWFEFIESIGGGLHVACSPVAVLGVSGSYSPELAYGSEPVPSSECGLYSPNLPEFGSLWALREQYDDGAHYLLEVRDV… |
| A0A2D6UHR7 | 31-299 | None |
| A0A2E0QVM5 | 14-221 | None |
| A0A843T2B6 | 43-382 | None |
| A0A1E3LK88 | 872-1190 | None |
| A0A353DIW8 | 18-262 | None |
| A0A037UP36 | 2-208 | None |
| A0A5M6IQW0 | 147-496 | None |
| A0A4Q2XC17 | 2-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.