DPCstruct | MC61855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 97 ± 14 aa |
| Standard deviation of domain lengths | 14.08 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519KAD5 | 9-95 | GVLEARLYSERPPRNEYVLTAKGKDLYGVLVTLHAWGAKHVYGEENAGLTMVHKACGHDLSPRIACGHCNEIVRPRDIQVIHDRSRM |
| Q9I3B4 | 55-146 | AARLRNLVEHGVMVAVPAESGSHQEYRLTDKGRALFPLLVAIRQWGEDYFFAPDESHVRLVERDSGQPVPRLQVRAGDGSPLAAEDT… |
| A0A2E0RUT2 | 116-219 | None |
| A0A379ZTU3 | 31-113 | None |
| A0A0K2R6E0 | 2-106 | None |
| A0A077FAX2 | 4-93 | None |
| A0A447WCZ1 | 2-87 | None |
| A0A2A2FPL1 | 48-144 | None |
| A0A6N3UFL1 | 1-72 | None |
| A0A7T0E0G8 | 2-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.