DPCstruct | MC61853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 105 ± 19 aa |
| Standard deviation of domain lengths | 18.79 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0097 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K5EK99 | 1-93 | MQNVINTVKGKALELAEYLTLESKFKETGVNTPEEFVAAGDYLVHHCLTWQWATGEELKVKAYLPTGKLFLVTKNVPCYKRCKQMEY… |
| W4IH35 | 7-96 | VKHKIGDTCRKLYSYFKTVNNTSTFIQNGTLTPSEFVDSGDFLVYKFKTWEWQEADKDRVVPYLPENKQFLITKNVPCKQRIKDLNN… |
| A0A2X0NUA1 | 5-114 | None |
| H0EMX1 | 1-106 | None |
| A0A091DWG9 | 39-160 | None |
| A0A0X3P6F0 | 1-108 | None |
| A0A4P1R1N7 | 1-93 | None |
| A0A0F4YGG8 | 420-516 | None |
| A0A815Q2R5 | 2-89 | None |
| A0A815Q438 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.