DPCstruct | MC61848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13243 |
|---|---|
| Mean domain length (aa) | 252 ± 59 aa |
| Standard deviation of domain lengths | 58.75 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 82.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.36 |
| Mean intra-cluster sequence similarity (%) | 14.23 |
| Pfam Score | 71.92 |
| Assigned Pfam label(s) | PF01462- PF14484- CL0219- CL0010- PF01463 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D2W5K3 | 53-288 | NDVNGQFLQNIANLEIKVLSNIYKKLILMKSLTSLCIPYVVGVKIDSESVTYIGQLKQLTSLEIQGMDIDDEHVESMAELKQLTSLY… |
| A0A0B0QKE2 | 22-165 | EALLNVAETRNCSQANQTLTKLTSLYLGENKISDIKPLSNLTNLTELSLSVNKISDIKPLSNLTNLTSLSLSGNQISDIKPLSNLTK… |
| A0A6D2HJQ4 | 2-188 | None |
| A0A6D2HR48 | 2-176 | None |
| A0A6D2I870 | 217-585 | None |
| A0A0A9NEW8 | 98-331 | None |
| A0A6D2I8S2 | 4-280 | None |
| A0A068UND1 | 220-488 | None |
| A0A068URA8 | 521-741 | None |
| A0A068US81 | 18-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.