DPCstruct | MC61843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 196 ± 24 aa |
| Standard deviation of domain lengths | 23.57 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 67.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D2W053 | 182-396 | SASKSKSKSKSTSKSKSKSKSKSKSKSKSKSKAKSKTKSKVKSKVKNVKPAVKPKVVVKPKVVVKPKVPVKPAVKAAPPASGRSSLS… |
| D2VVV1 | 1-181 | MSLVQHVNSSRPNCAEPLNTQNSGSSDSFGRKTLQAADQDVKLLNNKEGITSLLIDSMARNAMAQLSPSVFNGVLGPTNKYIPLVTF… |
| D2W051 | 323-547 | None |
| A0A6A5BCT4 | 1-222 | None |
| D2VHK1 | 47-208 | None |
| A0A6A5BDM1 | 109-279 | None |
| D2VN74 | 136-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.