DPCstruct | MC6184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 78 ± 7 aa |
| Standard deviation of domain lengths | 7.47 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 42.59 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF07583- CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C1AC93 | 149-224 | HWAWQPLQEPKAPAVKDAAWAKDDVDRFLLAKLEAQKLAPVADADKVTLIRRVTFDLTGLPPTPADVDAFVKDDSK |
| A0A2E3ECS7 | 30-110 | LFAEKKLWSLKPITEITVPANTKNDWSRNGIDDFILKKLFNESLTLSPRADRRSFIRRASYDLTGLPPSPETVKAFINDPS |
| A0A357TIG6 | 28-101 | None |
| A0A2V5MI05 | 66-159 | None |
| A0A7C4UBI3 | 125-205 | None |
| A0A3L7UMW8 | 1-68 | None |
| A0A2S7TX38 | 38-130 | None |
| A0A2S7U0F8 | 59-128 | None |
| A0A7C8DAD4 | 133-210 | None |
| A0A7C1T7T3 | 29-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.