DPCstruct | MC61838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 189 ± 28 aa |
| Standard deviation of domain lengths | 28.26 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.86 |
| Pfam Score | 87.32 |
| Assigned Pfam label(s) | PF16484- CL0149 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5MV01 | 25-208 | RAAYRTYNAITNRLYPVRPIVFGASLTAATAYHIKNPENAILKAFPKLGQKLIQIGTASFLTAYTPVFLLRCFLKYWFFSYKDWLFE… |
| A0A2G5T4D4 | 23-202 | FSYRTYNWLENRIWPVRPVPFLAIITTATGYQLRNIGFSDLQTNWQIIVKPLMISIGSVYTAVFVLRHFLKYFYFSYKGFLKENPKK… |
| A0A7R9ABK5 | 256-458 | None |
| A0A1S3R5E3 | 4-136 | None |
| A0A2T7P6S8 | 28-242 | None |
| A0A044UFP9 | 17-156 | None |
| A0A7R9L8T8 | 22-205 | None |
| L5K7L9 | 404-620 | None |
| H3AEI2 | 9-198 | None |
| A0A5K3F7P0 | 24-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.