DPCstruct | MC61837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 212 ± 36 aa |
| Standard deviation of domain lengths | 35.71 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.48 |
| Pfam Score | 73.29 |
| Assigned Pfam label(s) | PF18701- CL0543- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5MTZ3 | 453-659 | FLSSTSNLVKVRPIATSPSVSLNKANSSLRNDFDGETKKCHLDPEQIKCHPADDKMGYDATGNSLLQKALIDNKLPQIIEGNKVSKN… |
| A0A6V7UT68 | 140-370 | ILTETNGLKLAINAITKAPTPILATRFLTDDDKVMIADHLNSKLYCATQGEAESFSGCQLDADACKCSVTDPTVTCQCKNGRLDKII… |
| A0A0D6LYA2 | 60-230 | None |
| A0A0N4W5I8 | 2-176 | None |
| A0A6V7WLU0 | 40-246 | None |
| A0A6V7WDS1 | 134-356 | None |
| A0A821XY00 | 343-612 | None |
| A0A016TKS6 | 5-170 | None |
| A0A2A6CMD7 | 19-220 | None |
| A0A2H2I7G6 | 8-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.